JAKMIP1 antibody (Middle Region)
-
- Target See all JAKMIP1 Antibodies
- JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This JAKMIP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- JAKMIP1 antibody was raised against the middle region of JAKMIP1
- Purification
- Affinity purified
- Immunogen
- JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
- Top Product
- Discover our top product JAKMIP1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
JAKMIP1 Blocking Peptide, catalog no. 33R-2981, is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAKMIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))
- Alternative Name
- JAKMIP1 (JAKMIP1 Products)
- Synonyms
- MGC81051 antibody, Gababrbp antibody, JAMIP1 antibody, MARLIN1 antibody, 5830437M04Rik antibody, C330021K24Rik antibody, Marlin-1 antibody, janus kinase and microtubule interacting protein 1 antibody, janus kinase and microtubule interacting protein 1 L homeolog antibody, janus kinase and microtubule-interacting protein 1 antibody, Celf_2690 antibody, JAKMIP1 antibody, jakmip1.L antibody, LOC100070079 antibody, jakmip1 antibody, LOC100432594 antibody, Jakmip1 antibody
- Background
- JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.
- Molecular Weight
- 97 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-