DDX47 antibody
-
- Target See all DDX47 Antibodies
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DDX47 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ
- Top Product
- Discover our top product DDX47 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DDX47 Blocking Peptide, catalog no. 33R-1040, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX47 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
- Alternative Name
- DDX47 (DDX47 Products)
- Synonyms
- ddx47 antibody, DDX47 antibody, E4-DBP antibody, HQ0256 antibody, MSTP162 antibody, RRP3 antibody, 4930588A18Rik antibody, C77285 antibody, DEAD-box helicase 47 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 antibody, DEAD-box helicase 47 L homeolog antibody, DDX47 antibody, ddx47 antibody, Ddx47 antibody, ddx47.L antibody
- Background
- DDX47 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.
- Molecular Weight
- 50 kDa (MW of target protein)
-