RAD51AP1 antibody (Middle Region)
-
- Target See all RAD51AP1 Antibodies
- RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAD51AP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RAD51 AP1 antibody was raised against the middle region of RAD51 P1
- Purification
- Affinity purified
- Immunogen
- RAD51 AP1 antibody was raised using the middle region of RAD51 P1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD
- Top Product
- Discover our top product RAD51AP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAD51AP1 Blocking Peptide, catalog no. 33R-2308, is also available for use as a blocking control in assays to test for specificity of this RAD51AP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Concentration
- Lot specific
- Buffer
- Supplied as cell culture supernatant.
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))
- Alternative Name
- RAD51AP1 (RAD51AP1 Products)
- Synonyms
- PIR51 antibody, 2510006L10Rik antibody, RAB22 antibody, RAD51 associated protein 1 antibody, Rad51ap1 antibody, RAD51AP1 antibody
- Background
- RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.
- Molecular Weight
- 37 kDa (MW of target protein)
-