CARS antibody (N-Term)
-
- Target See all CARS Antibodies
- CARS (Cysteinyl-tRNA Synthetase (CARS))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CARS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CARS antibody was raised against the N terminal of CARS
- Purification
- Affinity purified
- Immunogen
- CARS antibody was raised using the N terminal of CARS corresponding to a region with amino acids MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY
- Top Product
- Discover our top product CARS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CARS Blocking Peptide, catalog no. 33R-6347, is also available for use as a blocking control in assays to test for specificity of this CARS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CARS (Cysteinyl-tRNA Synthetase (CARS))
- Alternative Name
- CARS (CARS Products)
- Synonyms
- sb:cb71 antibody, CARS antibody, BcDNA:LD21177 antibody, CG8431 antibody, CRS antibody, CysRS antibody, Dmel\\CG8431 antibody, BA0089 antibody, DDBDRAFT_0215191 antibody, DDBDRAFT_0231320 antibody, DDB_0215191 antibody, DDB_0231320 antibody, DDBDRAFT_0187313 antibody, DDBDRAFT_0231318 antibody, DDB_0187313 antibody, DDB_0231318 antibody, T16B12.16 antibody, K15E6.3 antibody, K15E6_3 antibody, CARS1 antibody, CYSRS antibody, MGC:11246 antibody, CA3 antibody, cysteinyl-tRNA synthetase antibody, Cysteinyl-tRNA synthetase antibody, cysteine--tRNA ligase antibody, cysteine-tRNA ligase antibody, Cysteinyl-tRNA synthetase, class Ia family protein antibody, cysteinyl-tRNA synthetase CysS antibody, cysteinyl-tRNA synthetase S homeolog antibody, CARS antibody, cars antibody, CysRS antibody, cysS antibody, APH_RS02395 antibody, mcysS antibody, SYCO ARATH antibody, AT3G56300 antibody, AT5G38830 antibody, cars.S antibody, Cars antibody
- Background
- CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.
- Molecular Weight
- 84 kDa (MW of target protein)
-