Ribonuclease H1 antibody (Middle Region)
-
- Target See all Ribonuclease H1 (RNASEH1) Antibodies
- Ribonuclease H1 (RNASEH1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Ribonuclease H1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNASEH1 antibody was raised against the middle region of RNASEH1
- Purification
- Affinity purified
- Immunogen
- RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
- Top Product
- Discover our top product RNASEH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNASEH1 Blocking Peptide, catalog no. 33R-2790, is also available for use as a blocking control in assays to test for specificity of this RNASEH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ribonuclease H1 (RNASEH1)
- Alternative Name
- RNASEH1 (RNASEH1 Products)
- Synonyms
- H1RNA antibody, RNH1 antibody, 74/9 antibody, CG8729 antibody, Dmel\\CG8729 antibody, RNase H1 antibody, RnH1 antibody, l(2)43F1-5 antibody, l(2)43Fa antibody, l(2)k07409 antibody, l(2)k07624 antibody, rnhl antibody, h1rna antibody, rnh1 antibody, zgc:91971 antibody, RNASEH1P1 antibody, RNASEH1 antibody, rnaseh1 antibody, Afu1g10020 antibody, Tb07.26A24.40 antibody, ribonuclease H1 antibody, ribonuclease H1 S homeolog antibody, ribonuclease H1 L homeolog antibody, ribonuclease HI antibody, Ribonuclease H1 antibody, RNASEH1 antibody, Rnaseh1 antibody, rnh1 antibody, rnaseh1.S antibody, rnaseh1 antibody, rnaseh1.L antibody, AFUA_1G10020 antibody, Tb927.7.4930 antibody, APH_RS00510 antibody
- Background
- RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.
- Molecular Weight
- 32 kDa (MW of target protein)
-