VDAC3 antibody (N-Term)
-
- Target See all VDAC3 Antibodies
- VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VDAC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VDAC3 antibody was raised against the N terminal of VDAC3
- Purification
- Affinity purified
- Immunogen
- VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF
- Top Product
- Discover our top product VDAC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VDAC3 Blocking Peptide, catalog no. 33R-4733, is also available for use as a blocking control in assays to test for specificity of this VDAC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))
- Alternative Name
- VDAC3 (VDAC3 Products)
- Synonyms
- HD-VDAC3 antibody, VDAC-3 antibody, VDAC1P5 antibody, VDAC5P antibody, VDAC3 antibody, wu:fb01e12 antibody, zgc:77898 antibody, hd-vdac3 antibody, ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 3 antibody, ATVDAC3 antibody, AtVDAC3 antibody, Athsr2 antibody, F2G14.210 antibody, F2G14_210 antibody, voltage dependent anion channel 3 antibody, voltage dependent anion channel 3 antibody, voltage-dependent anion channel 3 antibody, voltage-dependent anion channel 3 L homeolog antibody, VDAC3 antibody, Vdac3 antibody, vdac3 antibody, vdac3.L antibody
- Background
- VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase and glycerol kinase.
- Molecular Weight
- 31 kDa (MW of target protein)
-