CACNB2 antibody (C-Term)
-
- Target See all CACNB2 Antibodies
- CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CACNB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CACNB2 antibody was raised against the C terminal of CACNB2
- Purification
- Affinity purified
- Immunogen
- CACNB2 antibody was raised using the C terminal of CACNB2 corresponding to a region with amino acids RQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDH
- Top Product
- Discover our top product CACNB2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CACNB2 Blocking Peptide, catalog no. 33R-8117, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))
- Alternative Name
- CACNB2 (CACNB2 Products)
- Synonyms
- CACNLB2 antibody, CAVB2 antibody, MYSB antibody, AW060387 antibody, CAB2 antibody, Cavbeta2 antibody, Cchb2 antibody, Cacnlb2 antibody, Cacnb2 antibody, CACNB2 antibody, CACNB2.2 antibody, cacnb2a antibody, im:7141271 antibody, si:dkey-32m20.2 antibody, calcium voltage-gated channel auxiliary subunit beta 2 antibody, calcium channel, voltage-dependent, beta 2 subunit antibody, calcium channel, voltage-dependent, beta 2b antibody, CACNB2 antibody, Cacnb2 antibody, cacnb2b antibody
- Background
- CACNB2 is a subunit of voltage-dependent calcium (Ca2+) channels, expressed in the CNS. It appears to serve an obligatory function.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-