GABRA1 antibody

Catalog No. ABIN633786

Product Details anti-GABRA1 Antibody

Target: GABRA1 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 1 (GABRA1))

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GABRA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRA1 Blocking Peptide, catalog no. 33R-10072, is also available for use as a blocking control in assays to test for specificity of this GABRA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRA1

Target: GABRA1 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 1 (GABRA1))

Alternative Name: GABRA1 (GABRA1 Products)

Synonyms: ECA4 antibody, EJM antibody, EJM5 antibody, zgc:153566 antibody, Gabra-1 antibody, gamma-aminobutyric acid type A receptor alpha1 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, alpha 1 antibody, gamma-aminobutyric acid (GABA) A receptor, subunit alpha 1 antibody, gamma-aminobutyric acid receptor subunit alpha-1 antibody, GABRA1 antibody, Gabra1 antibody, gabra1 antibody, LOC100653509 antibody

Background: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Molecular Weight: 52 kDa (MW of target protein)