SDF2 antibody (Middle Region)
-
- Target See all SDF2 Antibodies
- SDF2 (Stromal Cell Derived Factor 2 (SDF2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SDF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SDF2 antibody was raised against the middle region of SDF2
- Purification
- Affinity purified
- Immunogen
- SDF2 antibody was raised using the middle region of SDF2 corresponding to a region with amino acids RDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEG
- Top Product
- Discover our top product SDF2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SDF2 Blocking Peptide, catalog no. 33R-7844, is also available for use as a blocking control in assays to test for specificity of this SDF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDF2 (Stromal Cell Derived Factor 2 (SDF2))
- Alternative Name
- SDF2 (SDF2 Products)
- Synonyms
- AI853825 antibody, fk23f01 antibody, wu:fk23f01 antibody, zgc:66291 antibody, stromal cell derived factor 2 antibody, stromal cell-derived factor 2 antibody, stromal cell derived factor 2 L homeolog antibody, sdf2 antibody, Sdf2 antibody, sdf2.L antibody, SDF2 antibody
- Background
- SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-