PAI1 antibody (C-Term)

Catalog No. ABIN634000

This Rabbit Polyclonal antibody specifically detects PAI1 in WB. It exhibits reactivity toward Human.

Quick Overview for PAI1 antibody (C-Term) (ABIN634000)

Target: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAI1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAI1 Antibody

Binding Specificity: C-Term

Specificity: SERPINE1 antibody was raised against the C terminal of SERPINE1

Purification: Affinity purified

Immunogen: SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINE1 Blocking Peptide, (ABIN5616072), is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAI1

Target: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Alternative Name: SERPINE1

Background: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: p53 Signaling, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy, Smooth Muscle Cell Migration