CTRP7 antibody (Middle Region)

Catalog No. ABIN634045

Product Details anti-CTRP7 Antibody

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTRP7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 QTNF7 antibody was raised against the middle region of C1 TNF7

Purification: Affinity purified

Immunogen: C1 QTNF7 antibody was raised using the middle region of C1 TNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1QTNF7 Blocking Peptide, catalog no. 33R-8542, is also available for use as a blocking control in assays to test for specificity of this C1QTNF7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTRP7

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Alternative Name: C1QTNF7 (C1QTNF7 Products)

Synonyms: C1QTNF7 antibody, 5530401N20Rik antibody, 8430425G24Rik antibody, Ctrp7 antibody, CTRP7 antibody, ZACRP7 antibody, C1q and tumor necrosis factor related protein 7 antibody, C1q and TNF related 7 antibody, C1QTNF7 antibody, C1qtnf7 antibody

Background: The specific function of C1QTNF7 is not yet known.

Molecular Weight: 31 kDa (MW of target protein)