CTRP7 antibody (Middle Region)
-
- Target See all CTRP7 (C1QTNF7) Antibodies
- CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CTRP7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 QTNF7 antibody was raised against the middle region of C1 TNF7
- Purification
- Affinity purified
- Immunogen
- C1 QTNF7 antibody was raised using the middle region of C1 TNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI
- Top Product
- Discover our top product C1QTNF7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1QTNF7 Blocking Peptide, catalog no. 33R-8542, is also available for use as a blocking control in assays to test for specificity of this C1QTNF7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))
- Alternative Name
- C1QTNF7 (C1QTNF7 Products)
- Synonyms
- C1QTNF7 antibody, 5530401N20Rik antibody, 8430425G24Rik antibody, Ctrp7 antibody, CTRP7 antibody, ZACRP7 antibody, C1q and tumor necrosis factor related protein 7 antibody, C1q and TNF related 7 antibody, C1QTNF7 antibody, C1qtnf7 antibody
- Background
- The specific function of C1QTNF7 is not yet known.
- Molecular Weight
- 31 kDa (MW of target protein)
-