SEMG1 antibody (Middle Region)

Catalog No. ABIN634064

Product Details anti-SEMG1 Antibody

Target: SEMG1 (Semenogelin I (SEMG1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEMG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Semenogelin I antibody was raised against the middle region of SEMG1

Purification: Affinity purified

Immunogen: Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Semenogelin I Blocking Peptide, catalog no. 33R-4289, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEMG1

Target: SEMG1 (Semenogelin I (SEMG1))

Alternative Name: Semenogelin I (SEMG1 Products)

Synonyms: SEMG1 antibody, SEMG1a antibody, CT103 antibody, SEMG antibody, SGI antibody, dJ172H20.2 antibody, RATSVPIIA antibody, SVPIIA antibody, SVS2P antibody, Svp1 antibody, Svs2 antibody, Svs2p2 antibody, BB115391 antibody, Semg1 antibody, SvsII antibody, semenogelin II antibody, semenogelin I antibody, semenogelin-2 antibody, seminal vesicle secretory protein 2 antibody, SEMG2 antibody, SEMG1 antibody, LOC100408385 antibody, Semg1 antibody, Svs2 antibody

Background: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides.

Molecular Weight: 40 kDa (MW of target protein)