RPA1 antibody (Middle Region)
-
- Target See all RPA1 Antibodies
- RPA1 (Replication Protein A1, 70kDa (RPA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPA1 antibody was raised against the middle region of RPA1
- Purification
- Affinity purified
- Immunogen
- RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI
- Top Product
- Discover our top product RPA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPA1 Blocking Peptide, catalog no. 33R-8749, is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPA1 (Replication Protein A1, 70kDa (RPA1))
- Alternative Name
- RPA1 (RPA1 Products)
- Synonyms
- HSSB antibody, MST075 antibody, REPA1 antibody, RF-A antibody, RP-A antibody, RPA70 antibody, Cb1-727 antibody, wu:fi14b08 antibody, zgc:55337 antibody, zgc:77092 antibody, RPA1 antibody, hssb antibody, mst075 antibody, repa1 antibody, rf-a antibody, rp-a antibody, rpa antibody, rpa70 antibody, LOC100230990 antibody, 5031405K23Rik antibody, 70kDa antibody, AA589576 antibody, AW557552 antibody, Rpa antibody, CG9633 antibody, D-RPA70 antibody, D-SSB antibody, DRP-A antibody, DmRPA antibody, Dmel\\CG9633 antibody, RPA antibody, RPA 70 antibody, RPA 70 kDa antibody, RpA70 antibody, Rpa-70 antibody, Ssb-70 antibody, dRP-A antibody, dmrpa1 antibody, i164 antibody, replication protein A1 antibody, replication protein A1, 70kDa antibody, replication protein A1 L homeolog antibody, Replication Protein A 70 antibody, RPA1 antibody, Rpa1 antibody, rpa1 antibody, rpa1.L antibody, RpA-70 antibody
- Background
- RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-