MCM2 antibody (Middle Region)

Catalog No. ABIN634144

Product Details anti-MCM2 Antibody

Target: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MCM2 antibody was raised against the middle region of MCM2

Purification: Affinity purified

Immunogen: MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM2 Blocking Peptide, catalog no. 33R-6804, is also available for use as a blocking control in assays to test for specificity of this MCM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM2

Target: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Alternative Name: MCM2 (MCM2 Products)

Synonyms: CG7538 antibody, DmMCM2 antibody, DmMcm2 antibody, DmeMCM2 antibody, Dmel\\CG7538 antibody, MCM2 antibody, MCM2-7 antibody, MCM2_DROME antibody, McM2 antibody, PCR3 antibody, dMCM2 antibody, l(3)rL074 antibody, XMcm2 antibody, bm28 antibody, ccnl1 antibody, cdc19 antibody, cdcl1 antibody, mitotin antibody, cb737 antibody, chunp6905 antibody, BM28 antibody, CCNL1 antibody, CDCL1 antibody, D3S3194 antibody, MITOTIN antibody, MCM7 antibody, AA959861 antibody, AW476101 antibody, Mcmd2 antibody, mKIAA0030 antibody, Minichromosome maintenance 2 antibody, minichromosome maintenance complex component 2 antibody, minichromosome maintenance complex component 2 L homeolog antibody, Mcm2 antibody, mcm2 antibody, MCM2 antibody, mcm2.L antibody

Background: This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins.

Molecular Weight: 102 kDa (MW of target protein)

Pathways: DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA