Cyclin B1 antibody (Middle Region)
-
- Target See all Cyclin B1 (CCNB1) Antibodies
- Cyclin B1 (CCNB1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cyclin B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cyclin B1 antibody was raised against the middle region of CCNB1
- Purification
- Affinity purified
- Immunogen
- Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
- Top Product
- Discover our top product CCNB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cyclin B1 Blocking Peptide, catalog no. 33R-1305, is also available for use as a blocking control in assays to test for specificity of this Cyclin B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cyclin B1 (CCNB1)
- Alternative Name
- Cyclin B1 (CCNB1 Products)
- Synonyms
- ccnb antibody, cycb antibody, cb267 antibody, cycb1 antibody, wu:fa19g04 antibody, wu:fb16d01 antibody, wu:fb16e07 antibody, wu:fi21c01 antibody, ccnb1 antibody, MGC53596 antibody, CCNB antibody, Ccnb1-rs1 antibody, Ccnb1-rs13 antibody, CycB1 antibody, Cycb-4 antibody, Cycb-5 antibody, Cycb1-rs1 antibody, cyclin B1 antibody, cyclin B1 S homeolog antibody, ccnb1 antibody, ccnb1.2 antibody, ccnb1.S antibody, CCNB1 antibody, Ccnb1 antibody, ccnb1.2.S antibody
- Background
- CCNB1 is a regulatory protein involved in mitosis. CCNB1 complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Cell Division Cycle, AMPK Signaling, Mitotic G1-G1/S Phases, M Phase
-