Cyclin B1 antibody (Middle Region)

Catalog No. ABIN634166

Product Details anti-Cyclin B1 Antibody

Target: Cyclin B1 (CCNB1)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cyclin B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cyclin B1 antibody was raised against the middle region of CCNB1

Purification: Affinity purified

Immunogen: Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin B1 Blocking Peptide, catalog no. 33R-1305, is also available for use as a blocking control in assays to test for specificity of this Cyclin B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cyclin B1

Target: Cyclin B1 (CCNB1)

Alternative Name: Cyclin B1 (CCNB1 Products)

Synonyms: ccnb antibody, cycb antibody, cb267 antibody, cycb1 antibody, wu:fa19g04 antibody, wu:fb16d01 antibody, wu:fb16e07 antibody, wu:fi21c01 antibody, ccnb1 antibody, MGC53596 antibody, CCNB antibody, Ccnb1-rs1 antibody, Ccnb1-rs13 antibody, CycB1 antibody, Cycb-4 antibody, Cycb-5 antibody, Cycb1-rs1 antibody, cyclin B1 antibody, cyclin B1 S homeolog antibody, ccnb1 antibody, ccnb1.2 antibody, ccnb1.S antibody, CCNB1 antibody, Ccnb1 antibody, ccnb1.2.S antibody

Background: CCNB1 is a regulatory protein involved in mitosis. CCNB1 complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Cell Division Cycle, AMPK Signaling, Mitotic G1-G1/S Phases, M Phase