RAD54L antibody

Catalog No. ABIN634218

Product Details anti-RAD54L Antibody

Target: RAD54L (RAD54-Like (RAD54L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD54L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAD54 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD54L Blocking Peptide, catalog no. 33R-9897, is also available for use as a blocking control in assays to test for specificity of this RAD54L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD54L

Target: RAD54L (RAD54-Like (RAD54L))

Alternative Name: RAD54L (RAD54L Products)

Synonyms: HR54 antibody, RAD54A antibody, hHR54 antibody, hRAD54 antibody, RAD54 antibody, zgc:56289 antibody, rad54l antibody, MGC69368 antibody, GdRAD54 antibody, RAD54-like antibody, RAD54L antibody, RAD54 like antibody, RAD54 like (S. cerevisiae) antibody, RAD54-like (S. cerevisiae) antibody, RAD54L antibody, Rad54l antibody, rad54l antibody

Background: This protein belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination.

Molecular Weight: 84 kDa (MW of target protein)

Pathways: DNA Damage Repair