DHX16 antibody
-
- Target See all DHX16 Antibodies
- DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHX16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHX16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPV
- Top Product
- Discover our top product DHX16 Primary Antibody
-
-
- Application Notes
-
WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHX16 Blocking Peptide, catalog no. 33R-4749, is also available for use as a blocking control in assays to test for specificity of this DHX16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX16 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16))
- Alternative Name
- DHX16 (DHX16 Products)
- Synonyms
- fa91b12 antibody, zgc:55590 antibody, wu:fa91b12 antibody, dbp2 antibody, ddx16 antibody, pro2014 antibody, prp2 antibody, prp8 antibody, prpf2 antibody, DHX16 antibody, DKFZp459L1130 antibody, DBP2 antibody, DDX16 antibody, PRO2014 antibody, PRP8 antibody, PRPF2 antibody, Prp2 antibody, 2410006N22Rik antibody, Ddx16 antibody, mKIAA0577 antibody, Dbp2 antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 16 antibody, DEAH-box helicase 16 antibody, putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 antibody, dhx16 antibody, DHX16 antibody, LOC100637149 antibody, Dhx16 antibody
- Background
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.
- Molecular Weight
- 115 kDa (MW of target protein)
-