RAD54B antibody

Catalog No. ABIN634225

Product Details anti-RAD54B Antibody

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD54B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAD54 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD54B Blocking Peptide, catalog no. 33R-6882, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD54B

Target: RAD54B (DNA repair and recombination protein RAD54B (RAD54B))

Alternative Name: RAD54B (RAD54B Products)

Synonyms: RAD54B antibody, im:7137737 antibody, im:7153525 antibody, fsbp antibody, rdh54 antibody, RDH54 antibody, E130016E03Rik antibody, Fsbp antibody, RGD1306507 antibody, RAD54 homolog B (S. cerevisiae) antibody, RAD54 homolog B L homeolog antibody, RAD54B antibody, rad54b antibody, rad54b.L antibody, Rad54b antibody

Background: RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.

Molecular Weight: 103 kDa (MW of target protein)