Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Jagged 2 (JAG2) antibody

Antigen

Jagged 2 (JAG2)
Synonyms HJ2, SER2, sm, Serh, D12Ggc2e, mJagged2-1, serB, zgc:152855, JAG2
Clonality Polyclonal
Host
Alternatives

Rabbit
Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634269
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies Variants back to top

Alternative name Jagged 2
Immunogen Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Description The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions.
Molecular Weight 130 kDa (MW of target protein)

Application Details
Alternatives Secondary Antibodies Variants back to top

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAG2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives
Application Details Secondary Antibodies Variants back to top

Alternatives for antigen "Jagged 2 (JAG2)", type "Antibodies"
Hosts Rabbit (27), Mouse (10)
Reactivities Human (35), Mouse (Murine) (3), Rat (Rattus) (2), Monkey (1)
Applications Flow Cytometry (FACS) (18), Immunofluorescence (IF) (18), Western Blotting (WB) (16), Enzyme Immunoassay (EIA) (14), ELISA (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunoprecipitation (IP) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)
Epitopes C-Term (2), AA 111-128 (1)