EGF antibody

Catalog No. ABIN634270

Product Details anti-EGF Antibody

Target: EGF (Epidermal Growth Factor (EGF))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EGF antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: EGF antibody was raised using a synthetic peptide corresponding to a region with amino acids ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EGF Blocking Peptide, catalog no. 33R-4179, is also available for use as a blocking control in assays to test for specificity of this EGF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EGF

Target: EGF (Epidermal Growth Factor (EGF))

Alternative Name: EGF (EGF Products)

Synonyms: HOMG4 antibody, URG antibody, AI790464 antibody, CEGF antibody, epidermal growth factor antibody, pro-epidermal growth factor antibody, EGF antibody, egf antibody, CpipJ_CPIJ020278 antibody, Egf antibody

Background: Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin.

Molecular Weight: 6 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, EGFR Downregulation