B-Cell Linker antibody (Middle Region)

Catalog No. ABIN634309

Product Details anti-B-Cell Linker Antibody

Target: B-Cell Linker (BLNK)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B-Cell Linker antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BLNK antibody was raised against the middle region of BLNK

Purification: Affinity purified

Immunogen: BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BLNK Blocking Peptide, catalog no. 33R-7788, is also available for use as a blocking control in assays to test for specificity of this BLNK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLNK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B-Cell Linker

Target: B-Cell Linker (BLNK)

Alternative Name: BLNK (BLNK Products)

Synonyms: BLNK antibody, blnk antibody, MGC147045 antibody, BASH antibody, Bca antibody, Ly-57 antibody, Ly57 antibody, Lyw-57 antibody, SLP-65 antibody, AGM4 antibody, BLNK-S antibody, LY57 antibody, SLP65 antibody, bca antibody, B-cell linker antibody, B cell linker antibody, BLNK antibody, blnk antibody, Blnk antibody

Background: This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: BCR Signaling