PDPK1 antibody (Middle Region)

Catalog No. ABIN634323

Product Details anti-PDPK1 Antibody

Target: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDPK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDK1 antibody was raised against the middle region of PDK1

Purification: Affinity purified

Immunogen: PDK1 antibody was raised using the middle region of PDK1 corresponding to a region with amino acids ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDK1 Blocking Peptide, catalog no. 33R-1567, is also available for use as a blocking control in assays to test for specificity of this PDK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDPK1

Target: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Alternative Name: PDK1 (PDPK1 Products)

Synonyms: pdpk1 antibody, MGC82080 antibody, PDK1 antibody, PDPK2 antibody, PRO0461 antibody, Pdk1 antibody, zgc:153787 antibody, 3'-phosphoinositide-dependent protein kinase 1 antibody, 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 antibody, ATPDK1 antibody, AtPDK1 antibody, T32M21.110 antibody, T32M21_110 antibody, zgc:77318 antibody, 3-phosphoinositide dependent protein kinase 1 antibody, 3-phosphoinositide dependent protein kinase 1 L homeolog antibody, 3-phosphoinositide dependent protein kinase-1 antibody, 3-phosphoinositide dependent protein kinase 1a antibody, 3-phosphoinositide-dependent protein kinase 1 antibody, 3'-phosphoinositide-dependent protein kinase 1 antibody, 3-phosphoinositide dependent protein kinase 1b antibody, PDPK1 antibody, pdpk1.L antibody, pdpk1 antibody, Pdpk1 antibody, pdpk1a antibody, LOC100380750 antibody, pdk-1 antibody, PDK1 antibody, pdpk1b antibody

Background: Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals