RAB5 antibody (Middle Region)
-
- Target See all RAB5 (RAB5A) Antibodies
- RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RAB5 A antibody was raised against the middle region of RAB5
- Purification
- Affinity purified
- Immunogen
- RAB5 A antibody was raised using the middle region of RAB5 corresponding to a region with amino acids KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS
- Top Product
- Discover our top product RAB5A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAB5A Blocking Peptide, catalog no. 33R-4691, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))
- Alternative Name
- RAB5A (RAB5A Products)
- Synonyms
- RAB5 antibody, 2410015H04Rik antibody, AI663973 antibody, AU021172 antibody, nnyRab5a antibody, DDBDRAFT_0168594 antibody, DDBDRAFT_0229401 antibody, DDB_0168594 antibody, DDB_0229401 antibody, rab5 antibody, RAB5A antibody, Rab5a antibody, rab5al antibody, zgc:56644 antibody, fj38g08 antibody, hm:zehn1144 antibody, rab5a antibody, wu:fj38g08 antibody, RAB5A, member RAS oncogene family antibody, rab5A protein antibody, Rab5a, GTPase antibody, predicted protein antibody, Rab GTPase antibody, RAB5A, member RAS oncogene family L homeolog antibody, RAB5A, member RAS oncogene family, b antibody, RAB5A, member RAS oncogene family, a antibody, RAB5A antibody, Rab5a antibody, rab5A antibody, rab5a antibody, rab5a.L antibody, rab5ab antibody, rab5aa antibody
- Background
- RAB5A is required for the fusion of plasma membranes and early endosomes.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity
-