TRPC4AP antibody (Middle Region)
-
- Target See all TRPC4AP Antibodies
- TRPC4AP (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 Associated Protein (TRPC4AP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPC4AP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPC4 AP antibody was raised against the middle region of TRPC4 P
- Purification
- Affinity purified
- Immunogen
- TRPC4 AP antibody was raised using the middle region of TRPC4 P corresponding to a region with amino acids GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH
- Top Product
- Discover our top product TRPC4AP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPC4AP Blocking Peptide, catalog no. 33R-3171, is also available for use as a blocking control in assays to test for specificity of this TRPC4AP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC0 P antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPC4AP (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 Associated Protein (TRPC4AP))
- Alternative Name
- TRPC4AP (TRPC4AP Products)
- Synonyms
- TRPC4AP antibody, MGC130977 antibody, 4833429F06Rik antibody, D2Ertd113e antibody, Trrp4ap antibody, mFLJ00177 antibody, truss antibody, C20orf188 antibody, TRRP4AP antibody, TRUSS antibody, transient receptor potential cation channel subfamily C member 4 associated protein antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein L homeolog antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein antibody, TRPC4AP antibody, trpc4ap.L antibody, trpc4ap antibody, Trpc4ap antibody
- Background
- TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.
- Molecular Weight
- 91 kDa (MW of target protein)
-