RAB40A antibody (Middle Region)
-
- Target See all RAB40A Antibodies
- RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB40A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RAB40 A antibody was raised against the middle region of RAB40
- Purification
- Affinity purified
- Immunogen
- RAB40 A antibody was raised using the middle region of RAB40 corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
- Top Product
- Discover our top product RAB40A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAB40A Blocking Peptide, catalog no. 33R-8107, is also available for use as a blocking control in assays to test for specificity of this RAB40A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB40A (RAB40A, Member RAS Oncogene Family (RAB40A))
- Alternative Name
- RAB40A (RAB40A Products)
- Synonyms
- RAR2 antibody, RAR2A antibody, RAB40A, member RAS oncogene family antibody, RAB40A antibody
- Background
- RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
- Molecular Weight
- 31 kDa (MW of target protein)
-