RAB5 antibody (Middle Region)

Catalog No. ABIN634434

Product Details anti-RAB5 Antibody

Target: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB5 A antibody was raised against the middle region of RAB5

Purification: Affinity purified

Immunogen: RAB5 A antibody was raised using the middle region of RAB5 corresponding to a region with amino acids SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB5A Blocking Peptide, catalog no. 33R-8417, is also available for use as a blocking control in assays to test for specificity of this RAB5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB5

Target: RAB5 (RAB5A) (RAB5A, Member RAS Oncogene Family (RAB5A))

Alternative Name: RAB5A (RAB5A Products)

Synonyms: RAB5 antibody, 2410015H04Rik antibody, AI663973 antibody, AU021172 antibody, nnyRab5a antibody, DDBDRAFT_0168594 antibody, DDBDRAFT_0229401 antibody, DDB_0168594 antibody, DDB_0229401 antibody, rab5 antibody, RAB5A antibody, Rab5a antibody, rab5al antibody, zgc:56644 antibody, fj38g08 antibody, hm:zehn1144 antibody, rab5a antibody, wu:fj38g08 antibody, RAB5A, member RAS oncogene family antibody, rab5A protein antibody, Rab5a, GTPase antibody, predicted protein antibody, Rab GTPase antibody, RAB5A, member RAS oncogene family L homeolog antibody, RAB5A, member RAS oncogene family, b antibody, RAB5A, member RAS oncogene family, a antibody, RAB5A antibody, Rab5a antibody, rab5A antibody, rab5a antibody, rab5a.L antibody, rab5ab antibody, rab5aa antibody

Background: RAB5A is required for the fusion of plasma membranes and early endosomes.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity