TAP1 antibody

Catalog No. ABIN634533

Product Details anti-TAP1 Antibody

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TAP1 Blocking Peptide, catalog no. 33R-5544, is also available for use as a blocking control in assays to test for specificity of this TAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TAP1

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Alternative Name: TAP1 (TAP1 Products)

Synonyms: ABC17 antibody, ABCB2 antibody, APT1 antibody, D6S114E antibody, PSF-1 antibody, PSF1 antibody, RING4 antibody, TAP1*0102N antibody, TAP1N antibody, abc17 antibody, abcb2 antibody, apt1 antibody, psf1 antibody, ring4 antibody, tap1a antibody, tap1n antibody, Abcb2 antibody, Ham-1 antibody, Ham1 antibody, MTP1 antibody, TAP antibody, Tap-1 antibody, Y3 antibody, Cim antibody, transporter 1, ATP binding cassette subfamily B member antibody, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog antibody, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) antibody, TAP1 antibody, tap1.L antibody, Tap1 antibody

Background: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).

Molecular Weight: 87 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process