HLA-DPA1 antibody (Middle Region)
-
- Target See all HLA-DPA1 Antibodies
- HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HLA-DPA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HLA-DPA1 antibody was raised against the middle region of HLA-DPA1
- Purification
- Affinity purified
- Immunogen
- HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
- Top Product
- Discover our top product HLA-DPA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HLA-DPA1 Blocking Peptide, catalog no. 33R-2275, is also available for use as a blocking control in assays to test for specificity of this HLA-DPA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DPA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))
- Alternative Name
- HLA-DPA1 (HLA-DPA1 Products)
- Synonyms
- DP(W3) antibody, DP(W4) antibody, HLA-DP1A antibody, HLADP antibody, HLASB antibody, PLT1 antibody, major histocompatibility complex, class II, DP alpha 1 antibody, HLA-DPA1 antibody
- Background
- HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- TCR Signaling, Cancer Immune Checkpoints
-