FEM1B antibody

Catalog No. ABIN634600

Product Details anti-FEM1B Antibody

Target: FEM1B (Fem-1 Homolog B (FEM1B))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FEM1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FEM1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FEM1B Blocking Peptide, catalog no. 33R-2032, is also available for use as a blocking control in assays to test for specificity of this FEM1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FEM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FEM1B

Target: FEM1B (Fem-1 Homolog B (FEM1B))

Alternative Name: FEM1B (FEM1B Products)

Synonyms: F1A-ALPHA antibody, F1AA antibody, FEM1-beta antibody, FEM1B antibody, mKIAA0396 antibody, fem-1 homolog B antibody, protein fem-1 homolog B antibody, fem-1 homolog B L homeolog antibody, fem-1 homolog b (C. elegans) antibody, feminization 1 homolog b (C. elegans) antibody, FEM1B antibody, Fem1b antibody, LOC413692 antibody, fem1b.L antibody, fem1b antibody

Background: FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.

Molecular Weight: 69 kDa (MW of target protein)