Mesothelin antibody (Middle Region)
-
- Target See all Mesothelin (MSLN) Antibodies
- Mesothelin (MSLN)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Mesothelin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Mesothelin antibody was raised against the middle region of MSLN
- Purification
- Affinity purified
- Immunogen
- Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVL
- Top Product
- Discover our top product MSLN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Mesothelin Blocking Peptide, catalog no. 33R-7609, is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSLN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Mesothelin (MSLN)
- Alternative Name
- Mesothelin (MSLN Products)
- Synonyms
- MPF antibody, SMRP antibody, MSLN antibody, mesothelin antibody, MSLN antibody, Msln antibody, LOC611363 antibody, LOC100524016 antibody
- Background
- An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium, mesotheliomas, and ovarian cancers.
- Molecular Weight
- 32 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process
-