ATP2B3 antibody (N-Term)
-
- Target See all ATP2B3 Antibodies
- ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP2B3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP2 B3 antibody was raised against the N terminal of ATP2 3
- Purification
- Affinity purified
- Immunogen
- ATP2 B3 antibody was raised using the N terminal of ATP2 3 corresponding to a region with amino acids GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE
- Top Product
- Discover our top product ATP2B3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP2B3 Blocking Peptide, catalog no. 33R-3204, is also available for use as a blocking control in assays to test for specificity of this ATP2B3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))
- Alternative Name
- ATP2B3 (ATP2B3 Products)
- Synonyms
- PMCA3 antibody, PMCA3a antibody, SCAX1 antibody, atp2b3 antibody, pmca3a antibody, zgc:92885 antibody, 6430519O13Rik antibody, Pmca3 antibody, ATPase plasma membrane Ca2+ transporting 3 antibody, ATPase, Ca++ transporting, plasma membrane 3a antibody, ATPase, Ca++ transporting, plasma membrane 3 antibody, plasma membrane calcium-transporting ATPase 2 antibody, ATP2B3 antibody, atp2b3a antibody, Atp2b3 antibody, atp2b3 antibody, LOC100639471 antibody
- Background
- ATP2B3 gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.
- Molecular Weight
- 134 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-