PLGRKT antibody (Middle Region)
-
- Target See all PLGRKT Antibodies
- PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLGRKT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C9 ORF46 antibody was raised against the middle region of C9 rf46
- Purification
- Affinity purified
- Immunogen
- C9 ORF46 antibody was raised using the middle region of C9 rf46 corresponding to a region with amino acids AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL
- Top Product
- Discover our top product PLGRKT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C9ORF46 Blocking Peptide, catalog no. 33R-1270, is also available for use as a blocking control in assays to test for specificity of this C9ORF46 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF46 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))
- Alternative Name
- C9ORF46 (PLGRKT Products)
- Synonyms
- C9orf46 antibody, MDS030 antibody, PLG-RKT antibody, Plg-R(KT) antibody, RGD1306839 antibody, 1110007H22Rik antibody, 5033414D02Rik antibody, AI852040 antibody, Plg-RKT antibody, plasminogen receptor with a C-terminal lysine antibody, plasminogen receptor, C-terminal lysine transmembrane protein antibody, PLGRKT antibody, Plgrkt antibody
- Background
- The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 17 kDa (MW of target protein)
-