SPTLC1 antibody (Middle Region)

Catalog No. ABIN635127

Cited in 1 publication. The Rabbit Polyclonal anti-SPTLC1 antibody (ABIN635127) specifically detects SPTLC1 in WB and IHC. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SPTLC1 antibody (Middle Region) (ABIN635127)

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPTLC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SPTLC1 Antibody

Binding Specificity: Middle Region

Specificity: SPTLC1 antibody was raised against the middle region of SPTLC1

Purification: Affinity purified

Immunogen: SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPTLC1 Blocking Peptide, (ABIN939291), is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-SPTLC1 antibody (ABIN635127)

Klas, Copic, Direder, Laggner, Prucksamas, Gruber, Ankersmit, Mildner: "Transcriptional Differences in Lipid-Metabolizing Enzymes in Murine Sebocytes Derived from Sebaceous Glands of the Skin and Preputial Glands." in: International journal of molecular sciences, Vol. 22, Issue 21, (2021) (PubMed).

Target Details for SPTLC1

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Alternative Name: SPTLC1

Background: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

Molecular Weight: 53 kDa (MW of target protein)