LAX1 antibody (Middle Region)
-
- Target See all LAX1 Antibodies
- LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LAX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LAX1 antibody was raised against the middle region of LAX1
- Purification
- Affinity purified
- Immunogen
- LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS
- Top Product
- Discover our top product LAX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LAX1 Blocking Peptide, catalog no. 33R-4955, is also available for use as a blocking control in assays to test for specificity of this LAX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))
- Alternative Name
- LAX1 (LAX1 Products)
- Synonyms
- LAX antibody, A530029E09 antibody, E430019B13Rik antibody, lymphocyte transmembrane adaptor 1 antibody, LAX1 antibody, Lax1 antibody
- Background
- LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-