SECTM1 antibody (Middle Region)
-
- Target See all SECTM1 Antibodies
- SECTM1 (Secreted and Transmembrane 1 (SECTM1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SECTM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SECTM1 antibody was raised against the middle region of SECTM1
- Purification
- Affinity purified
- Immunogen
- SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV
- Top Product
- Discover our top product SECTM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SECTM1 Blocking Peptide, catalog no. 33R-1467, is also available for use as a blocking control in assays to test for specificity of this SECTM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SECTM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SECTM1 (Secreted and Transmembrane 1 (SECTM1))
- Alternative Name
- SECTM1 (SECTM1 Products)
- Synonyms
- K12 antibody, secreted and transmembrane 1 antibody, SECTM1 antibody
- Background
- This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
- Molecular Weight
- 27 kDa (MW of target protein)
-