ATP2A3 antibody (Middle Region)

Catalog No. ABIN635430

Product Details anti-ATP2A3 Antibody

Target: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP2A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP2 A3 antibody was raised against the middle region of ATP2 3

Purification: Affinity purified

Immunogen: ATP2 A3 antibody was raised using the middle region of ATP2 3 corresponding to a region with amino acids LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP2A3 Blocking Peptide, catalog no. 33R-5064, is also available for use as a blocking control in assays to test for specificity of this ATP2A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP2A3

Target: ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))

Alternative Name: ATP2A3 (ATP2A3 Products)

Synonyms: serca3 antibody, si:dkey-205l20.1 antibody, ATP2A3 antibody, Atp2a3 antibody, SERCA3 antibody, SERCA3b antibody, Serca3 antibody, SERCA antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 L homeolog antibody, ATPase, Ca++ transporting, ubiquitous antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 antibody, atp2a3.L antibody, atp2a3 antibody, ATP2A3 antibody, Atp2a3 antibody

Background: ATP2A3 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

Molecular Weight: 109 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Ribonucleoside Biosynthetic Process