CYP46A1 antibody (C-Term)
-
- Target See all CYP46A1 Antibodies
- CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP46A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP46 A1 antibody was raised against the C terminal of CYP46 1
- Purification
- Affinity purified
- Immunogen
- CYP46 A1 antibody was raised using the C terminal of CYP46 1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM
- Top Product
- Discover our top product CYP46A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP46A1 Blocking Peptide, catalog no. 33R-10280, is also available for use as a blocking control in assays to test for specificity of this CYP46A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP40 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))
- Alternative Name
- CYP46A1 (CYP46A1 Products)
- Synonyms
- CP46 antibody, CYP46 antibody, CYP46A1 antibody, zgc:109896 antibody, MGC147389 antibody, Cyp46 antibody, cytochrome P450 family 46 subfamily A member 1 antibody, cytochrome P450 family 46 subfamily A member 1 L homeolog antibody, cytochrome P450, family 46, subfamily A, polypeptide 1, tandem duplicate 1 antibody, cytochrome P450, family 46 antibody, cytochrome P450 46A1 antibody, cytochrome P450, family 46, subfamily a, polypeptide 1 antibody, cholesterol 24-hydroxylase antibody, cytochrome P450, family 46, subfamily A, polypeptide 1 antibody, CYP46A1 antibody, cyp46a1.L antibody, cyp46a1.1 antibody, cyp46a1 antibody, PTRG_08343 antibody, PTRG_09667 antibody, Cyp46a1 antibody, Sgly_1093 antibody
- Background
- CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molecular Weight
- 57 kDa (MW of target protein)
-