UGT8 antibody (Middle Region)
-
- Target See all UGT8 Antibodies
- UGT8 (UDP Glycosyltransferase 8 (UGT8))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UGT8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UGT8 antibody was raised against the middle region of µgT8
- Purification
- Affinity purified
- Immunogen
- UGT8 antibody was raised using the middle region of µgT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI
- Top Product
- Discover our top product UGT8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UGT8 Blocking Peptide, catalog no. 33R-3336, is also available for use as a blocking control in assays to test for specificity of this µgT8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGT8 (UDP Glycosyltransferase 8 (UGT8))
- Alternative Name
- UGT8 (UGT8 Products)
- Synonyms
- Xlcgt antibody, cgt antibody, ugt4 antibody, AI850488 antibody, AW455908 antibody, Cgt antibody, Ugt8 antibody, mCerGT antibody, CGT antibody, UGT4 antibody, Ugt8a antibody, UDP glycosyltransferase 8 antibody, UDP galactosyltransferase 8A antibody, UGT8 antibody, ugt8 antibody, Ugt8a antibody, Ugt8 antibody
- Background
- Galactocerebrosides are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system and are also present in small amounts in kidney. The key enzymatic step in the biosynthesis of galactocerebrosides consists of the transfer of galactose to ceramide catalyzed by UDP-galactose ceramide galactosyltransferase. The enzyme UGT8 is the first involved in complex lipid biosynthesis in the myelinating oligodendrocyte.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-