LRFN3 antibody (C-Term)
-
- Target See all LRFN3 Antibodies
- LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRFN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRFN3 antibody was raised against the C terminal of LRFN3
- Purification
- Affinity purified
- Immunogen
- LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS
- Top Product
- Discover our top product LRFN3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRFN3 Blocking Peptide, catalog no. 33R-9926, is also available for use as a blocking control in assays to test for specificity of this LRFN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))
- Alternative Name
- LRFN3 (LRFN3 Products)
- Synonyms
- FIGLER1 antibody, SALM4 antibody, A530045B06Rik antibody, Salm4 antibody, LRFN3 antibody, leucine rich repeat and fibronectin type III domain containing 3 antibody, LRFN3 antibody, Lrfn3 antibody
- Background
- LRFN3 belongs to the LRFN family. Its exact function remains unknown.
- Molecular Weight
- 66 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-