CYP3A4 antibody (Middle Region)
-
- Target See all CYP3A4 Antibodies
- CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP3A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP3 A43 antibody was raised against the middle region of CYP3 43
- Purification
- Affinity purified
- Immunogen
- CYP3 A43 antibody was raised using the middle region of CYP3 43 corresponding to a region with amino acids ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII
- Top Product
- Discover our top product CYP3A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP3A43 Blocking Peptide, catalog no. 33R-2706, is also available for use as a blocking control in assays to test for specificity of this CYP3A43 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 43 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))
- Alternative Name
- CYP3A43 (CYP3A4 Products)
- Synonyms
- CP33 antibody, CP34 antibody, CYP3A antibody, CYP3A3 antibody, CYPIIIA3 antibody, CYPIIIA4 antibody, HLP antibody, NF-25 antibody, P450C3 antibody, P450PCN1 antibody, MGC108372 antibody, CYP3A80 antibody, CYP3A4 antibody, CYP3A21 antibody, CYPIIIA21 antibody, CYP3A12 antibody, cytochrome P450 family 3 subfamily A member 4 antibody, cytochrome P450 family 3 subfamily A member 43 antibody, cytochrome P450 3A4 antibody, cytochrome P450, subfamily IIIA, polypeptide 4 antibody, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 antibody, cytochrome P450, family 3, subfamily A, polypeptide 4 antibody, CYP3A4 antibody, CYP3A43 antibody, PTRG_01782 antibody, PTRG_06060 antibody, cyp3a4 antibody
- Background
- CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-