CA4 antibody (C-Term)
-
- Target See all CA4 Antibodies
- CA4 (Carbonic Anhydrase IV (CA4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carbonic Anhydrase IV antibody was raised against the C terminal of CA4
- Purification
- Affinity purified
- Immunogen
- Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
- Top Product
- Discover our top product CA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1176, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CA4 (Carbonic Anhydrase IV (CA4))
- Alternative Name
- Carbonic Anhydrase IV (CA4 Products)
- Synonyms
- CAIV antibody, Car4 antibody, RP17 antibody, AW456718 antibody, Ca4 antibody, ca4 antibody, caiv antibody, car4 antibody, rp17 antibody, CA4 antibody, zgc:171842 antibody, carbonic anhydrase 4 antibody, carbonic anhydrase 4 S homeolog antibody, carbonic anhydrase IV a antibody, CA4 antibody, Car4 antibody, ca4 antibody, ca4.S antibody, Ca4 antibody, ca4a antibody
- Background
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known.
- Molecular Weight
- 34 kDa (MW of target protein)
-