GPAA1 antibody

Catalog No. ABIN635865

Product Details anti-GPAA1 Antibody

Target: GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPAA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: GPAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPAA1 Blocking Peptide, catalog no. 33R-4996, is also available for use as a blocking control in assays to test for specificity of this GPAA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPAA1

Target: GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))

Alternative Name: GPAA1 (GPAA1 Products)

Synonyms: GAA1 antibody, hGAA1 antibody, C80044 antibody, mGAA1 antibody, glycosylphosphatidylinositol anchor attachment 1 antibody, GPI anchor attachment protein 1 antibody, GPAA1 antibody, Gpaa1 antibody

Background: Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Maintenance of Protein Location, SARS-CoV-2 Protein Interactome