MGAT2 antibody
-
- Target See all MGAT2 Antibodies
- MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MGAT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
- Top Product
- Discover our top product MGAT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGAT2 Blocking Peptide, catalog no. 33R-10048, is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGAT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))
- Alternative Name
- MGAT2 (MGAT2 Products)
- Synonyms
- CDG2A antibody, CDGS2 antibody, GLCNACTII antibody, GNT-II antibody, GNT2 antibody, CG7921 antibody, Dmel\\CG7921 antibody, GlcNAc-TII antibody, GlcNAcT2 antibody, dMGAT2 antibody, MGC89475 antibody, Gnt2 antibody, AA407964 antibody, CH73-301C19.1 antibody, zgc:162268 antibody, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase antibody, CG7921 gene product from transcript CG7921-RB antibody, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase L homeolog antibody, mannoside acetylglucosaminyltransferase 2 antibody, MGAT2 antibody, Mgat2 antibody, mgat2.L antibody, mgat2 antibody
- Background
- MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans.
- Molecular Weight
- 51 kDa (MW of target protein)
-