PTGS1 antibody (Middle Region)

Catalog No. ABIN635890

Product Details anti-PTGS1 Antibody

Target: PTGS1 (Prostaglandin-Endoperoxide Synthase 1 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTGS1 antibody was raised against the middle region of PTGS1

Purification: Affinity purified

Immunogen: PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTGS1 Blocking Peptide, catalog no. 33R-3265, is also available for use as a blocking control in assays to test for specificity of this PTGS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTGS1

Target: PTGS1 (Prostaglandin-Endoperoxide Synthase 1 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS1))

Alternative Name: PTGS1 (PTGS1 Products)

Synonyms: COX-1 antibody, cox-1 antibody, PTGS1 antibody, Ptgs1 antibody, COX1 antibody, Cox-1 antibody, Cox-3 antibody, PGHS-1 antibody, PHS 1 antibody, Pghs1 antibody, Cox1 antibody, Cox3 antibody, cox1 antibody, zCOX-1 antibody, COX3 antibody, PCOX1 antibody, PES-1 antibody, PGG/HS antibody, PGHS1 antibody, PHS1 antibody, PTGHS antibody, COX-3 antibody, prostaglandin-endoperoxide synthase 1 antibody, cyclooxygenase-1 antibody, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) antibody, prostaglandin-endoperoxide synthase 1 S homeolog antibody, PTGS1 antibody, cox-1 antibody, Ptgs1 antibody, ptgs1 antibody, ptgs1.S antibody

Background: Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis.

Molecular Weight: 66 kDa (MW of target protein)