DNAJC1 antibody
-
- Target See all DNAJC1 Antibodies
- DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNAJC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT
- Top Product
- Discover our top product DNAJC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNAJC1 Blocking Peptide, catalog no. 33R-7786, is also available for use as a blocking control in assays to test for specificity of this DNAJC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))
- Alternative Name
- DNAJC1 (DNAJC1 Products)
- Synonyms
- dnajc1l antibody, zgc:152779 antibody, DNAJL1 antibody, ERdj1 antibody, HTJ1 antibody, MTJ1 antibody, 4733401K02Rik antibody, AA960110 antibody, D230036H06Rik antibody, Dnajl1 antibody, ERj1p antibody, DnaJ heat shock protein family (Hsp40) member C1 antibody, DnaJ (Hsp40) homolog, subfamily C, member 1 antibody, DnaJ heat shock protein family (Hsp40) member C1 S homeolog antibody, dnajc1 antibody, DNAJC1 antibody, Dnajc1 antibody, dnajc1.S antibody
- Background
- DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.
- Molecular Weight
- 64 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-