PON3 antibody (Middle Region)
-
- Target See all PON3 Antibodies
- PON3 (Paraoxonase 3 (PON3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PON3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PON3 antibody was raised against the middle region of PON3
- Purification
- Affinity purified
- Immunogen
- PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY
- Top Product
- Discover our top product PON3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PON3 Blocking Peptide, catalog no. 33R-7223, is also available for use as a blocking control in assays to test for specificity of this PON3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PON3 (Paraoxonase 3 (PON3))
- Alternative Name
- PON3 (PON3 Products)
- Synonyms
- 2810004E20 antibody, AI786302 antibody, paraoxonase 3 antibody, PON3 antibody, Pon3 antibody
- Background
- This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL).
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-