ACVR2B antibody (Middle Region)
-
- Target See all ACVR2B Antibodies
- ACVR2B (Activin A Receptor, Type IIB (ACVR2B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACVR2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACVR2 B antibody was raised against the middle region of ACVR2
- Purification
- Affinity purified
- Immunogen
- ACVR2 B antibody was raised using the middle region of ACVR2 corresponding to a region with amino acids LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV
- Top Product
- Discover our top product ACVR2B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACVR2B Blocking Peptide, catalog no. 33R-4822, is also available for use as a blocking control in assays to test for specificity of this ACVR2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACVR2B (Activin A Receptor, Type IIB (ACVR2B))
- Alternative Name
- ACVR2B (ACVR2B Products)
- Synonyms
- ACVR2B antibody, XAR1 antibody, actr-iib antibody, actriib antibody, ACTRIIB antibody, ActR-IIB antibody, HTX4 antibody, ActRIIB antibody, actr2b antibody, actrIIb antibody, wu:fj97d11 antibody, activin A receptor type 2B antibody, activin A receptor type 2B L homeolog antibody, activin A receptor type 2Ba antibody, activin receptor IIB antibody, ACVR2B antibody, acvr2b antibody, acvr2b.L antibody, Acvr2b antibody, acvr2ba antibody
- Background
- Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Hormone Transport, Cancer Immune Checkpoints
-