ST6GALNAC1 antibody
-
- Target See all ST6GALNAC1 Antibodies
- ST6GALNAC1 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 1 (ST6GALNAC1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST6GALNAC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ST6 GALNAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL
- Top Product
- Discover our top product ST6GALNAC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST6GALNAC1 Blocking Peptide, catalog no. 33R-5049, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST6GALNAC1 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 1 (ST6GALNAC1))
- Alternative Name
- ST6GALNAC1 (ST6GALNAC1 Products)
- Synonyms
- HSY11339 antibody, SIAT7A antibody, ST6GalNAcI antibody, STYI antibody, Siat7a antibody, Siat7A antibody, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 antibody, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 antibody, ST6GALNAC1 antibody, St6galnac1 antibody
- Background
- Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues. The cancer-associated sialyl-Tn (sTn) antigen is formed by ST6GALNAC1-catalyzed sialylation of GalNAc residues on mucins.
- Molecular Weight
- 68 kDa (MW of target protein)
-