Insulin Receptor antibody (Middle Region)

Catalog No. ABIN636083

The Rabbit Polyclonal anti-Insulin Receptor antibody is suitable to detect Insulin Receptor in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Insulin Receptor antibody (Middle Region) (ABIN636083)

Target: Insulin Receptor (INSR)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Insulin Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Insulin Receptor Antibody

Binding Specificity: Middle Region

Specificity: INSR antibody was raised against the middle region of INSR

Purification: Affinity purified

Immunogen: INSR antibody was raised using the middle region of INSR corresponding to a region with amino acids ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INSR Blocking Peptide, (ABIN937998), is also available for use as a blocking control in assays to test for specificity of this INSR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Insulin Receptor

Target: Insulin Receptor (INSR)

Alternative Name: INSR

Background: This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin.

Molecular Weight: 154 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, RTK Signaling, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity