AMH antibody

Catalog No. ABIN643496

Product Details anti-AMH Antibody

Target: AMH (Anti-Mullerian Hormone (AMH))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This AMH antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Mouse Anti-Human AMH

Specificity: DS-MB-02769 is specific for human anti-mullerian hormone (AMH), originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. DS-MB-02769 is reported to crossreact with mouse.

Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)

Isotype: IgG1

Application Details

Restrictions: For Research Use only

Handling

Format: Liquid

Preservative: Sodium azide

Precaution of Use: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for AMH

Target: AMH (Anti-Mullerian Hormone (AMH))

Alternative Name: AMH (AMH Products)

Synonyms: AMH antibody, amh antibody, MIF antibody, MIS antibody, anti-Mullerian hormone antibody, amh antibody, AMH antibody, Amh antibody

Pathways: Negative Regulation of Hormone Secretion